TPTE Peptide - middle region
TPTE Peptide - middle region
Product Specifications
Product Name Alternative
TPTE
UniProt
P56180
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TPTE Rabbit Polyclonal Antibody (orb575543) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SQKRYVAYFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEME
More Discoveries
Explore Other Products
Browse additional items from our catalog
032587-ML490 100 µL
BRP44, CT (BRP44, Mitochondrial pyruvate carrier 2, Brain protein 44) (MaxLight 490) discontinued
Sign In for Pricing
View Details 
orb2702519 5 Plate
Human ICAM-1/CD54 ELISA Kit (DIY Antibody Pairs)
Sign In for Pricing
View Details