Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF35 Peptide - N-terminal region

ZNF35 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZNF35

UniProt

P13682

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF35 Rabbit Polyclonal Antibody (orb575569) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005265501

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQASSQQVHSENIKVWAPVQGLQTGLDGSEEEEKGQNISWDMAVVLKATQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroglobulin (TG) Mouse Monoclonal Antibody [Clone ID: 2H11]
AM33242PU-S 100 µg

Thyroglobulin (TG) Mouse Monoclonal Antibody [Clone ID: 2H11]

Sign In for Pricing
View Details
Recombinant PDZK1 Antibody
RC-4522-01 50 μL

Recombinant PDZK1 Antibody

Sign In for Pricing
View Details
Recombinant PDZK1 Antibody
RC-4522-02 100 µL

Recombinant PDZK1 Antibody

Sign In for Pricing
View Details
Recombinant PDZK1 Antibody
RC-4522-03 1 mL

Recombinant PDZK1 Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Ovary
CR566318 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details
Digital Display Ultrasonic Cleaner BULC-302
BULC-302 1 Unit

Digital Display Ultrasonic Cleaner BULC-302

Sign In for Pricing
View Details