ZNF35 Peptide - N-terminal region
ZNF35 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ZNF35
UniProt
P13682
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF35 Rabbit Polyclonal Antibody (orb575569) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
XP_005265501
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GQASSQQVHSENIKVWAPVQGLQTGLDGSEEEEKGQNISWDMAVVLKATQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PE/Cyanine5.5 Anti-Mouse CD45.2 Antibody[104.2]](https://cdn.genprice.uk/products/763/68dd14a4061270361e7d1274/imageurl/e-ab-f1122i.webp)
E-AB-F1122I-01 50 Tests
PE/Cyanine5.5 Anti-Mouse CD45.2 Antibody[104.2]
Sign In for Pricing
View Details E-AB-F1122I-02 100 Tests
PE/Cyanine5.5 Anti-Mouse CD45.2 Antibody[104.2]
Sign In for Pricing
View Details E-AB-F1122I-03 2x 100 Tests
PE/Cyanine5.5 Anti-Mouse CD45.2 Antibody[104.2]
Sign In for Pricing
View Details 
TP310234M 100 µg
KLRA1 (KLRA1P) (NM_006611) Human Recombinant Protein
Sign In for Pricing
View Details 