Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SALL4 Peptide - N-terminal region

SALL4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SALL4, ZNF797

UniProt

Q9UJQ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SALL4 Rabbit Polyclonal Antibody (orb330054) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065169

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KPQHINSEEDQGEQQPQQQTPEFADAAPAAPAAGELGAPVNHPGNDEVAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Phospho-HSL (Ser855) Polyclonal Antibody
TMAC-02029-01 50 μL

Anti-Phospho-HSL (Ser855) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-HSL (Ser855) Polyclonal Antibody
TMAC-02029-02 100 µL

Anti-Phospho-HSL (Ser855) Polyclonal Antibody

Sign In for Pricing
View Details
SLC22A24 Polyclonal Antibody
MBS2560570-01 0.02 mL

SLC22A24 Polyclonal Antibody

Sign In for Pricing
View Details
SLC22A24 Polyclonal Antibody
MBS2560570-02 0.06 mL

SLC22A24 Polyclonal Antibody

Sign In for Pricing
View Details
SLC22A24 Polyclonal Antibody
MBS2560570-03 0.12 mL

SLC22A24 Polyclonal Antibody

Sign In for Pricing
View Details
SLC22A24 Polyclonal Antibody
MBS2560570-04 0.2 mL

SLC22A24 Polyclonal Antibody

Sign In for Pricing
View Details