Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SALL4 Peptide - N-terminal region

SALL4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SALL4, ZNF797

UniProt

Q9UJQ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SALL4 Rabbit Polyclonal Antibody (orb330054) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065169

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KPQHINSEEDQGEQQPQQQTPEFADAAPAAPAAGELGAPVNHPGNDEVAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR3C1
326269 100 µL

NR3C1

Sign In for Pricing
View Details
PSCA Rabbit Polyclonal Antibody
orb630276-01 50 µg

PSCA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PSCA Rabbit Polyclonal Antibody
orb630276-02 100 µg

PSCA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MTUS2 Antibody (C-Term) [ApR04991G]
ApR04991G-01 50 µL

MTUS2 Antibody (C-Term) [ApR04991G]

Sign In for Pricing
View Details
MTUS2 Antibody (C-Term) [ApR04991G]
ApR04991G-02 100 µL

MTUS2 Antibody (C-Term) [ApR04991G]

Sign In for Pricing
View Details
MTUS2 Antibody (C-Term) [ApR04991G]
ApR04991G-03 200 µL

MTUS2 Antibody (C-Term) [ApR04991G]

Sign In for Pricing
View Details