Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF410 Peptide - C-terminal region

ZNF410 Peptide - C-terminal region

Product Specifications

Product Name Alternative

APA1, APA-1

UniProt

Q86VK4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF410 Rabbit Polyclonal Antibody (orb324799) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSPRSLSSVPDVTHHLVTMQSGRQSYEVSVLTAVNPQELLNQGDLTERRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Ethyl-2-thioxo-2,3-dihydropyrimidin-4(1H)-one
TRC-B440190-1G 1 g

6-Ethyl-2-thioxo-2,3-dihydropyrimidin-4(1H)-one

Sign In for Pricing
View Details
NF-kB p65 (RELA) pThr254 Rabbit Polyclonal Antibody
AP01651PU-N 100 µg

NF-kB p65 (RELA) pThr254 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vortex Mixer BVMX-103
BVMX-103 1 Unit

Vortex Mixer BVMX-103

Sign In for Pricing
View Details
LCMT1 (NM_001032391) Human Over-expression Lysate
LC422323 20 µg

LCMT1 (NM_001032391) Human Over-expression Lysate

Sign In for Pricing
View Details
B3GNT3 Rabbit Polyclonal Antibody
TA372092 100 µL

B3GNT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mini-PCR BTHC-202
BTHC-202 1 Unit

Mini-PCR BTHC-202

Sign In for Pricing
View Details