ZNF410 Peptide - C-terminal region
ZNF410 Peptide - C-terminal region
Product Specifications
Product Name Alternative
APA1, APA-1
UniProt
Q86VK4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF410 Rabbit Polyclonal Antibody (orb324799) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GSPRSLSSVPDVTHHLVTMQSGRQSYEVSVLTAVNPQELLNQGDLTERRT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSV030197 100 µg
Recombinant HIV-2 gp36 Protein (subtype CRF01_AB, strain 07JP_NMC716_clone_01) (His & MBP Tag)
Sign In for Pricing
View Details 
BNUM1395-50 1x 50 µL
CD31 / PECAM-1 (Endothelial Cell Marker) (C31/1395R), 1mg/mL
Sign In for Pricing
View Details ![GAPDH Mouse Monoclonal Antibody [Clone ID: 1A10A10]](https://cdn.genprice.uk/products/937/68dd189b061270361e8fc628/imageurl/am11014pu-n.webp)
AM11014PU-N 400 µL
GAPDH Mouse Monoclonal Antibody [Clone ID: 1A10A10]
Sign In for Pricing
View Details 
