Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BHLHE41 Peptide - C-terminal region

BHLHE41 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DEC2, hDEC2, BHLHB3, SHARP1

UniProt

Q9C0J9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BHLHE41 Rabbit Polyclonal Antibody (orb324810) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_110389

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLPHEVAPLGAPHPQHPHGRTHLPFAGPREPGNPESSAQEDPSQPGKEAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXA3 Recombinant Protein (Human)
RP012445 100 µg

FOXA3 Recombinant Protein (Human)

Sign In for Pricing
View Details
Anti-Human PDGFB Antibody (SAA0449), PerCP
FHB91214 100 Tests

Anti-Human PDGFB Antibody (SAA0449), PerCP

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YGR250C Polyclonal Antibody
MBS7159923 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YGR250C Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Phospho-VE-Cadherin (Tyr731) (Human)
B2024487 50 µL

Rabbit Polyclonal Phospho-VE-Cadherin (Tyr731) (Human)

Sign In for Pricing
View Details
RPL35AP27 3'UTR Luciferase Stable Cell Line
TU021445 1.0 mL

RPL35AP27 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Mouse IL-33
RPF11554-01 50 µg

Recombinant Mouse IL-33

Sign In for Pricing
View Details