Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BHLHE41 Peptide - C-terminal region

BHLHE41 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DEC2, hDEC2, BHLHB3, SHARP1

UniProt

Q9C0J9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BHLHE41 Rabbit Polyclonal Antibody (orb324810) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_110389

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLPHEVAPLGAPHPQHPHGRTHLPFAGPREPGNPESSAQEDPSQPGKEAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse MOGT2 Rabbit Polyclonal Antibody
E10G30199 100 µL

Mouse MOGT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDC45 Antibody
49284-01 50 µL

CDC45 Antibody

Sign In for Pricing
View Details
CDC45 Antibody
49284-02 100 µL

CDC45 Antibody

Sign In for Pricing
View Details
ATP3 siRNA Oligos set (Human)
53115171 3x 5 nmol

ATP3 siRNA Oligos set (Human)

Sign In for Pricing
View Details
ITGB3BP Protein Lysate (Mouse) with C-HA Tag
25173034 100 µg

ITGB3BP Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Mouse CD81, clone 1D6 (Monoclonal) Antibody
orb302416 0.2 mg

Mouse CD81, clone 1D6 (Monoclonal) Antibody

Sign In for Pricing
View Details