Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMRTC2 Peptide - N-terminal region

DMRTC2 Peptide - N-terminal region

Product Specifications

UniProt

Q8IXT2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMRTC2 Rabbit Polyclonal Antibody (orb324815) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005259205

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPSDMPAGYHCPLDSAPWDETRDPQSTELIPRRAISRSPTCARCRNHGVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Serpin B13 (SERPINB13) ELISA Kit
abx517379 96 Tests

Mouse Serpin B13 (SERPINB13) ELISA Kit

Sign In for Pricing
View Details
P38 MAPK Antibody FITC Conjugated
orb1543599 100 µL

P38 MAPK Antibody FITC Conjugated

Sign In for Pricing
View Details
Ran Lentiviral Activation Particles (m)
sc-422594-LAC 200 µL

Ran Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
ELISA Kit For Immunoglobulin E
E0545h 96 Tests

ELISA Kit For Immunoglobulin E

Sign In for Pricing
View Details
MZF1 (Myeloid Zinc Finger 1, MZF-1, Zinc Finger and SCAN Domain-containing Protein 6, Zinc Finger Protein 42, MZF, ZNF42, ZSCAN6) (MaxLight 750)
MBS6234035-01 0.1 mL

MZF1 (Myeloid Zinc Finger 1, MZF-1, Zinc Finger and SCAN Domain-containing Protein 6, Zinc Finger Protein 42, MZF, ZNF42, ZSCAN6) (MaxLight 750)

Sign In for Pricing
View Details
MZF1 (Myeloid Zinc Finger 1, MZF-1, Zinc Finger and SCAN Domain-containing Protein 6, Zinc Finger Protein 42, MZF, ZNF42, ZSCAN6) (MaxLight 750)
MBS6234035-02 5x 0.1 mL

MZF1 (Myeloid Zinc Finger 1, MZF-1, Zinc Finger and SCAN Domain-containing Protein 6, Zinc Finger Protein 42, MZF, ZNF42, ZSCAN6) (MaxLight 750)

Sign In for Pricing
View Details