Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMRTC2 Peptide - N-terminal region

DMRTC2 Peptide - N-terminal region

Product Specifications

UniProt

Q8IXT2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMRTC2 Rabbit Polyclonal Antibody (orb324815) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005259205

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPSDMPAGYHCPLDSAPWDETRDPQSTELIPRRAISRSPTCARCRNHGVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Arachidonate 15-Lipoxygenase (ALOX15) ELISA Kit
CK-bio-28579-01 48 Tests

Rat Arachidonate 15-Lipoxygenase (ALOX15) ELISA Kit

Sign In for Pricing
View Details
Rat Arachidonate 15-Lipoxygenase (ALOX15) ELISA Kit
CK-bio-28579-02 96 Tests

Rat Arachidonate 15-Lipoxygenase (ALOX15) ELISA Kit

Sign In for Pricing
View Details
Rat Arachidonate 15-Lipoxygenase (ALOX15) ELISA Kit
CK-bio-28579-03 5x 96 Tests

Rat Arachidonate 15-Lipoxygenase (ALOX15) ELISA Kit

Sign In for Pricing
View Details
Rat Arachidonate 15-Lipoxygenase (ALOX15) ELISA Kit
CK-bio-28579-04 10x 96 Tests

Rat Arachidonate 15-Lipoxygenase (ALOX15) ELISA Kit

Sign In for Pricing
View Details
Slc9a3r2 (NM_023055) Mouse Tagged ORF Clone
MG223689 10 µg

Slc9a3r2 (NM_023055) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
pBluescriptR-PRDM8 Plasmid
PVT17742 2 µg

pBluescriptR-PRDM8 Plasmid

Sign In for Pricing
View Details