Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UXT Peptide - C-terminal region

UXT Peptide - C-terminal region

Product Specifications

Product Name Alternative

UXT, HSPC024

UniProt

Q9UBK9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UXT Rabbit Polyclonal Antibody (orb330521) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Fluoro-2- (trifluoromethyl) pyridine
425526-01 250 mg

3-Fluoro-2- (trifluoromethyl) pyridine

Sign In for Pricing
View Details
3-Fluoro-2- (trifluoromethyl) pyridine
425526-02 1 g

3-Fluoro-2- (trifluoromethyl) pyridine

Sign In for Pricing
View Details
GPR120 Polyclonal Antibody, FITC Conjugated
bs-8596R-FITC 100 µL

GPR120 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Rabbit Anti PAK1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 120ul
IRBAMLPAK1AP831120UL 120 µL

Rabbit Anti PAK1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 120ul

Sign In for Pricing
View Details
ACTB Antibody - middle region
MBS3205044-01 0.1 mL

ACTB Antibody - middle region

Sign In for Pricing
View Details
ACTB Antibody - middle region
MBS3205044-02 5x 0.1 mL

ACTB Antibody - middle region

Sign In for Pricing
View Details