Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UXT Peptide - C-terminal region

UXT Peptide - C-terminal region

Product Specifications

Product Name Alternative

UXT, HSPC024

UniProt

Q9UBK9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UXT Rabbit Polyclonal Antibody (orb330521) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Rtf1 (NM_030112) AAV Particle
MR215339A1V 250 µL

Mouse Rtf1 (NM_030112) AAV Particle

Sign In for Pricing
View Details
pUNO1-hCSF2
puno1-hcsf2 20 µg

pUNO1-hCSF2

Sign In for Pricing
View Details
Olfr1178 (NM_001011868) Mouse Tagged Lenti ORF Clone
MR212812L3 10 µg

Olfr1178 (NM_001011868) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Gamma-Aminobutyric Acid Receptor Subunit Epsilon (GABRE) Antibody (ATTO 680)
abx441937 100 µg

Gamma-Aminobutyric Acid Receptor Subunit Epsilon (GABRE) Antibody (ATTO 680)

Sign In for Pricing
View Details
Magic™ Human EGFR CHO-S Cell Line
S01YF-0424-KX3 1 Vial

Magic™ Human EGFR CHO-S Cell Line

Sign In for Pricing
View Details
Tsen15 Mouse qPCR Primer Pair (NM_025677)
MP214086 200 Reactions

Tsen15 Mouse qPCR Primer Pair (NM_025677)

Sign In for Pricing
View Details