PLG Peptide - middle region
PLG Peptide - middle region
Product Specifications
UniProt
P00747
Field of Research
Cardiovascular Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLG Rabbit Polyclonal Antibody (orb325672) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000292
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GA100096 1 Kit
Human Adenosine A3 Receptor (ADORA3) activation kit by CRISPRa
Sign In for Pricing
View Details 