SLC25A48 Peptide - middle region
SLC25A48 Peptide - middle region
Product Specifications
UniProt
Q6ZT89
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLC25A48 Rabbit Polyclonal Antibody (orb325789) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RRESMFGFFKGMSFPLASIAVYNSVVFGVFSNTQRFLSQHRCGEPEASPP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB3287-100 1x 100 µL
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3287), 0.2mg/mL
Sign In for Pricing
View Details 
BNC472004-100 1x 100 µL
CD134, Mouse (OX40) (OX-86), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details