CATSPERE Peptide - N-terminal region
CATSPERE Peptide - N-terminal region
Product Specifications
Product Name Alternative
C1orf101, C10orf101
UniProt
Q5SY80
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CATSPERE Rabbit Polyclonal Antibody (orb326028) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_776168
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CFLWYYRVRHFFNNFTQLITVWAYDPESADPDELLGNAEEPSINSIVLST
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940633-100 1x 100 µL
Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880146-100 1x 100 µL
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040146-500 1x 500 µL
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 