Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THOC7 Peptide - C-terminal region

THOC7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

THOC7, NIF3L1BP1

UniProt

Q6I9Y2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THOC7 Rabbit Polyclonal Antibody (orb586756) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_079351

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEMA4B Antibody
orb1559107-01 50 µL

SEMA4B Antibody

Sign In for Pricing
View Details
SEMA4B Antibody
orb1559107-02 100 µL

SEMA4B Antibody

Sign In for Pricing
View Details
SEMA4B Antibody
orb1559107-03 200 µL

SEMA4B Antibody

Sign In for Pricing
View Details
Z-Guggulsterone
SIH-591-5MG 5 mg

Z-Guggulsterone

Sign In for Pricing
View Details
ZFX Antibody
25478 100 µL

ZFX Antibody

Sign In for Pricing
View Details
Lentiviral human ZNF324B sgRNA gene knockout kit - Lentiviral human ZNF324B sgRNA gene knockout kit (100)
GTR15390907 1 Vial

Lentiviral human ZNF324B sgRNA gene knockout kit - Lentiviral human ZNF324B sgRNA gene knockout kit (100)

Sign In for Pricing
View Details