Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THOC7 Peptide - C-terminal region

THOC7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

THOC7, NIF3L1BP1

UniProt

Q6I9Y2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THOC7 Rabbit Polyclonal Antibody (orb586756) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_079351

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1D shRNA Plasmid (h)
sc-94710-SH 20 µg

C1D shRNA Plasmid (h)

Sign In for Pricing
View Details
PGAP3 Antibody
MBS543722-01 0.1 mg

PGAP3 Antibody

Sign In for Pricing
View Details
PGAP3 Antibody
MBS543722-02 5x 0.1 mg

PGAP3 Antibody

Sign In for Pricing
View Details
GFR alpha 3 Antibody
1137-002mg 0.02 mg

GFR alpha 3 Antibody

Sign In for Pricing
View Details
mouse anti-human BCMA mAb(1M)
E409C22-m100 100μL

mouse anti-human BCMA mAb(1M)

Sign In for Pricing
View Details
ULK4 ORF Vector (Human) (pORF)
49164011 1.0 µg DNA

ULK4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details