Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3A2 Peptide - N-terminal region

SF3A2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SF3A2, SAP62

UniProt

Q15428

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SF3A2 Rabbit Polyclonal Antibody (orb588109) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_009096

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-Tmeff1-3×FLAG-Neo Plasmid
PVT49755 2 µg

pCMV-Tmeff1-3×FLAG-Neo Plasmid

Sign In for Pricing
View Details
ARL6IP5 Antibody, Biotin conjugated
A13129-100UG 100 µg

ARL6IP5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Lentiviral mouse Fus shRNA (UAS) - Lentiviral mouse Fus shRNA (UAS, GFP) (100)
GTR15278673 1 Vial

Lentiviral mouse Fus shRNA (UAS) - Lentiviral mouse Fus shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
CCDC65 sgRNA CRISPR Lentivector (Human) (Target 1)
K0378402 1.0 µg DNA

CCDC65 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Calpain 2 Recombinant Antibody, RBITC Conjugated
bsm-61574R-RBITC-01 20 µL

Calpain 2 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Calpain 2 Recombinant Antibody, RBITC Conjugated
bsm-61574R-RBITC-02 100 µL

Calpain 2 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details