Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT6A Peptide - middle region

CCT6A Peptide - middle region

Product Specifications

Product Name Alternative

CCT6, Cctz, HTR3, TCPZ, TCP20, MoDP-2, TTCP20, CCT-zeta, CCT-zeta-1, TCP-1-zeta

UniProt

P40227

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCT6A Rabbit Polyclonal Antibody (orb327231) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HAGLVYEYTLGEEKFTFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRDGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKB alpha (NFKBIA) Rabbit Monoclonal Antibody [Clone ID: R05-4K3]
TA384866 100 µL

IKB alpha (NFKBIA) Rabbit Monoclonal Antibody [Clone ID: R05-4K3]

Sign In for Pricing
View Details
Asap3 Mouse Gene Knockout Kit (CRISPR)
KN501646 1 Kit

Asap3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Zfp930 Mouse Gene Knockout Kit (CRISPR)
KN520027 1 Kit

Zfp930 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NEK6 (NM_001145001) Human Over-expression Lysate
LY428635 100 µg

NEK6 (NM_001145001) Human Over-expression Lysate

Sign In for Pricing
View Details
Barnidipine Hydrochloride
TRC-B118700-5MG 5 mg

Barnidipine Hydrochloride

Sign In for Pricing
View Details
Angiotensin II Trifluoroacetic Acid Salt (Human)
TRC-A637965-1MG 1 mg

Angiotensin II Trifluoroacetic Acid Salt (Human)

Sign In for Pricing
View Details