CCT6A Peptide - middle region
CCT6A Peptide - middle region
Product Specifications
Product Name Alternative
CCT6, Cctz, HTR3, TCPZ, TCP20, MoDP-2, TTCP20, CCT-zeta, CCT-zeta-1, TCP-1-zeta
UniProt
P40227
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCT6A Rabbit Polyclonal Antibody (orb327231) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HAGLVYEYTLGEEKFTFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRDGL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![pro Caspase 10 Recombinant Rabbit Monoclonal Antibody [JE59-42]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea8118c/imageurl/ha722029.webp)
HA722029 100 µL
pro Caspase 10 Recombinant Rabbit Monoclonal Antibody [JE59-42]
Sign In for Pricing
View Details 
HA750873 100 µL
MAPK6 / ERK3 Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 