CDC25B Peptide - C-terminal region
CDC25B Peptide - C-terminal region
Product Specifications
Product Name Alternative
CDC25HU2
UniProt
P30305
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDC25B Rabbit Polyclonal Antibody (orb327232) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_068659
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882288-100 1x 100 µL
SOX9 / SRY-box 9 (rSOX9/2288), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP20576PU-N 100 µg
Inhibin beta C chain (INHBC) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
