Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC25B Peptide - C-terminal region

CDC25B Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDC25HU2

UniProt

P30305

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDC25B Rabbit Polyclonal Antibody (orb327232) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_068659

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OGR1 (GPR68) (N-term) Rabbit Polyclonal Antibody
AP06934PU-N 50 µg

OGR1 (GPR68) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS504749 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Phospho-TrkB (Y817) Recombinant Rabbit monoclonal Antibody
HA750213 100 µL

Phospho-TrkB (Y817) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tegafur-13C,15N2
TRC-T013903-1MG 1 mg

Tegafur-13C,15N2

Sign In for Pricing
View Details
CA12 Antibody
KC-22760-01 50 μL

CA12 Antibody

Sign In for Pricing
View Details
CA12 Antibody
KC-22760-02 100 µL

CA12 Antibody

Sign In for Pricing
View Details