Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGB5 Peptide - C-terminal region

ITGB5 Peptide - C-terminal region

Product Specifications

UniProt

P18084

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITGB5 Rabbit Polyclonal Antibody (orb327243) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002204

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ECLLLHSGKPDNQTCHSLCRDEVITWVDTIVKDDQEAVLCFYKTAKDCVM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TP53, Phosphorylated (S315) (Tumor Protein p53, P53, BCC7, LFS1, TRP53) (APC)
MBS6441314-01 0.1 mL

TP53, Phosphorylated (S315) (Tumor Protein p53, P53, BCC7, LFS1, TRP53) (APC)

Sign In for Pricing
View Details
TP53, Phosphorylated (S315) (Tumor Protein p53, P53, BCC7, LFS1, TRP53) (APC)
MBS6441314-02 5x 0.1 mL

TP53, Phosphorylated (S315) (Tumor Protein p53, P53, BCC7, LFS1, TRP53) (APC)

Sign In for Pricing
View Details
DOK2, Phosphorylated (Y299) (Docking Protein 2, p56DOK, p56dok-2) (MaxLight 550)
MBS6414601-01 0.1 mL

DOK2, Phosphorylated (Y299) (Docking Protein 2, p56DOK, p56dok-2) (MaxLight 550)

Sign In for Pricing
View Details
DOK2, Phosphorylated (Y299) (Docking Protein 2, p56DOK, p56dok-2) (MaxLight 550)
MBS6414601-02 5x 0.1 mL

DOK2, Phosphorylated (Y299) (Docking Protein 2, p56DOK, p56dok-2) (MaxLight 550)

Sign In for Pricing
View Details
FMO3 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62346R-BF405-01 20 µL

FMO3 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
FMO3 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62346R-BF405-02 100 µL

FMO3 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details