Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGB5 Peptide - C-terminal region

ITGB5 Peptide - C-terminal region

Product Specifications

UniProt

P18084

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITGB5 Rabbit Polyclonal Antibody (orb327243) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002204

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ECLLLHSGKPDNQTCHSLCRDEVITWVDTIVKDDQEAVLCFYKTAKDCVM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Bromothiophene-2-sulfonyl chloride
435904-01 500 mg

5-Bromothiophene-2-sulfonyl chloride

Sign In for Pricing
View Details
5-Bromothiophene-2-sulfonyl chloride
435904-02 1 g

5-Bromothiophene-2-sulfonyl chloride

Sign In for Pricing
View Details
EphA2 (phospho Tyr588) Polyclonal Antibody
MBS8519872-01 0.1 mg

EphA2 (phospho Tyr588) Polyclonal Antibody

Sign In for Pricing
View Details
EphA2 (phospho Tyr588) Polyclonal Antibody
MBS8519872-02 0.1 mL (AF635)

EphA2 (phospho Tyr588) Polyclonal Antibody

Sign In for Pricing
View Details
EphA2 (phospho Tyr588) Polyclonal Antibody
MBS8519872-03 0.1 mL (AF610)

EphA2 (phospho Tyr588) Polyclonal Antibody

Sign In for Pricing
View Details
EphA2 (phospho Tyr588) Polyclonal Antibody
MBS8519872-04 0.1 mL (AF405S)

EphA2 (phospho Tyr588) Polyclonal Antibody

Sign In for Pricing
View Details