KIF13A Peptide - N-terminal region
KIF13A Peptide - N-terminal region
Product Specifications
Product Name Alternative
RBKIN, bA500C11.2
UniProt
Q9H1H9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KIF13A Rabbit Polyclonal Antibody (orb327244) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_071396
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PPSNTKQGERKPPKVFAFDYCFWSMDESNTTKYAGQEVVFKCLGEGILEK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040257-500 1x 500 µL
Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041775-100 1x 100 µL
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681228-100 1x 100 µL
CD6 (C6/372 + 3F7B5), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details