Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MARK2 Peptide - C-terminal region

MARK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MARK2 {ECO:0000312|EMBL:AAH08771.2, , EMK1

UniProt

Q7KZI7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MARK2 Rabbit Polyclonal Antibody (orb588135) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IPTSNSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABAA Rr1 shRNA Plasmid (m)
sc-42458-SH 20 µg

GABAA Rr1 shRNA Plasmid (m)

Sign In for Pricing
View Details
RIN1 Antibody
MBS9407946-01 0.05 mL

RIN1 Antibody

Sign In for Pricing
View Details
RIN1 Antibody
MBS9407946-02 0.1 mL

RIN1 Antibody

Sign In for Pricing
View Details
RIN1 Antibody
MBS9407946-03 5x 0.1 mL

RIN1 Antibody

Sign In for Pricing
View Details
LDHA sgRNA CRISPR Lentivector (Human) (Target 1)
K2822202 1.0 µg DNA

LDHA sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI9H2]
CF502341 100 µg

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI9H2]

Sign In for Pricing
View Details