MELK Peptide - middle region
MELK Peptide - middle region
Product Specifications
Product Name Alternative
MELK, KIAA0175
UniProt
Q14680
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MELK Rabbit Polyclonal Antibody (orb331451) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP762236 50 µg
IL20 Receptor alpha (IL20RA) (NM_014432) Human Recombinant Protein
Sign In for Pricing
View Details 
BNCB0717-100 1x 100 µL
CD1a (O10 + C1A/711), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
