Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MELK Peptide - middle region

MELK Peptide - middle region

Product Specifications

Product Name Alternative

MELK, KIAA0175

UniProt

Q14680

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MELK Rabbit Polyclonal Antibody (orb331451) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAAF4 Human qPCR Primer Pair (NM_130810)
HP231068 200 Reactions

DNAAF4 Human qPCR Primer Pair (NM_130810)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS707534 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (GP1.4), 1mg/mL
BNUM0159-50 1x 50 µL

Mucin 1 / EMA / Episialin / CD227 (GP1.4), 1mg/mL

Sign In for Pricing
View Details
TremL1 Mouse Gene Knockout Kit (CRISPR)
KN518164 1 Kit

TremL1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAS Antibody (Biotin)
KB-8370-01 50 μL

FAS Antibody (Biotin)

Sign In for Pricing
View Details
FAS Antibody (Biotin)
KB-8370-02 100 µL

FAS Antibody (Biotin)

Sign In for Pricing
View Details