POT1 Peptide - C-terminal region
POT1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
GLM9, CMM10, HPOT1
UniProt
Q9NUX5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POT1 Rabbit Polyclonal Antibody (orb327255) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
XP_006715980
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QNTSLYDSKIWTTKNQKGRKVAVHFVKNNGILPLSNECLLLIEGGTLSEI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSM040301 50 µg
Recombinant Mouse MERTK/MER Protein (His & GST Tag)
Sign In for Pricing
View Details 
TRC-D229593-2.5MG 2.5 mg
Dehydroepiandrosterone (Dhea) (16,16-D2, 97%)
Sign In for Pricing
View Details ![Sialidase-3 Mouse Monoclonal Antibody [Clone ID: 11B]](https://cdn.genprice.uk/products/937/68dd189c061270361e8fcc73/imageurl/am26497af-n.webp)
AM26497AF-N 100 µg
Sialidase-3 Mouse Monoclonal Antibody [Clone ID: 11B]
Sign In for Pricing
View Details 
E-MSEL-M0066-01 24 Tests
Mini Sample Mouse IgG (Immunoglobulin G) ELISA Kit
Sign In for Pricing
View Details