Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POT1 Peptide - C-terminal region

POT1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GLM9, CMM10, HPOT1

UniProt

Q9NUX5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POT1 Rabbit Polyclonal Antibody (orb327255) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_006715980

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QNTSLYDSKIWTTKNQKGRKVAVHFVKNNGILPLSNECLLLIEGGTLSEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFAP (GA-5 + ASTRO/789), CF640R conjugate, 0.1mg/mL
BNC400898-500 1x 500 µL

GFAP (GA-5 + ASTRO/789), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Islet 1 (ISL1) Rabbit Polyclonal Antibody
TA384550 100 µL

Islet 1 (ISL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Texas Red Conjugated Helix aspersa Lectin (Garden Snail) -HAA-
T-3801-1 1 mg

Texas Red Conjugated Helix aspersa Lectin (Garden Snail) -HAA-

Sign In for Pricing
View Details
GFOD1 Human Gene Knockout Kit (CRISPR)
KN415584 1 Kit

GFOD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARL15 Rabbit Polyclonal Antibody
TA373676 100 µL

ARL15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Caveolin 3 (CAV3) (NM_001234) Human Over-expression Lysate
LY420058 100 µg

Caveolin 3 (CAV3) (NM_001234) Human Over-expression Lysate

Sign In for Pricing
View Details