Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SORBS1 Peptide - middle region

SORBS1 Peptide - middle region

Product Specifications

Product Name Alternative

CAP, FLAF2, R85FL, SH3D5, SORB1, SH3P12

UniProt

Q9BX66

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SORBS1 Rabbit Polyclonal Antibody (orb327281) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_006717658

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SEMSYIDGEKVVKRSATLPLPARSSSLKSSSERNDWEPPDKKVDTRKYRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAK1 pThr423/402/421 Rabbit Polyclonal Antibody
AP02447PU-N 100 µL

PAK1 pThr423/402/421 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human OX40/TNFRSF4 Protein (Fc Tag)
PKSH032844-01 10 µg

Recombinant Human OX40/TNFRSF4 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human OX40/TNFRSF4 Protein (Fc Tag)
PKSH032844-02 50 µg

Recombinant Human OX40/TNFRSF4 Protein (Fc Tag)

Sign In for Pricing
View Details
BMF Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F4]
TA807524AM 100 µL

BMF Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F4]

Sign In for Pricing
View Details
Annexin V, FITC Labeled
20030-AAT 100 Tests

Annexin V, FITC Labeled

Sign In for Pricing
View Details
CYLD (NM_001042412) Human Over-expression Lysate
LY420886 100 µg

CYLD (NM_001042412) Human Over-expression Lysate

Sign In for Pricing
View Details