Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAP2 Peptide - N-terminal region

STAP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

STAP2, BKS

UniProt

Q9UGK3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STAP2 Rabbit Polyclonal Antibody (orb588180) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HVEKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLECREM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Pancreas
CS503252 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details
Gamma tubuLin complex component 3 (TUBGCP3) (NM_006322) Human Recombinant Protein
TP307395M 100 µg

Gamma tubuLin complex component 3 (TUBGCP3) (NM_006322) Human Recombinant Protein

Sign In for Pricing
View Details
5-Ethynyl-2’-deoxyuridine
TRC-E932175-100MG 100 mg

5-Ethynyl-2’-deoxyuridine

Sign In for Pricing
View Details
MFSD6 (NM_017694) Human Recombinant Protein
TP319252L 1 mg

MFSD6 (NM_017694) Human Recombinant Protein

Sign In for Pricing
View Details
Laboratory Water Purification System BLPS-702
BLPS-702 1 Unit

Laboratory Water Purification System BLPS-702

Sign In for Pricing
View Details
Tissue FFPE Sections, Adrenal gland
CS802234 5x 5 µm

Tissue FFPE Sections, Adrenal gland

Sign In for Pricing
View Details