Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAP2 Peptide - N-terminal region

STAP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

STAP2, BKS

UniProt

Q9UGK3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STAP2 Rabbit Polyclonal Antibody (orb588180) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HVEKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLECREM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hif1a Mouse Gene Knockout Kit (CRISPR)
KN307708 1 Kit

Hif1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Eph receptor B4 (EPHB4) Mouse Monoclonal Antibody [Clone ID: 5B5]
AM06328SU-N 100 µL

Eph receptor B4 (EPHB4) Mouse Monoclonal Antibody [Clone ID: 5B5]

Sign In for Pricing
View Details
Human ANGPTL6 activation kit by CRISPRa
GA113275 1 Kit

Human ANGPTL6 activation kit by CRISPRa

Sign In for Pricing
View Details
TP53TG5 Antibody
KC-32586-01 50 μL

TP53TG5 Antibody

Sign In for Pricing
View Details
TP53TG5 Antibody
KC-32586-02 100 µL

TP53TG5 Antibody

Sign In for Pricing
View Details
TP53TG5 Antibody
KC-32586-03 1 mL

TP53TG5 Antibody

Sign In for Pricing
View Details