DGCR8 Peptide - middle region
DGCR8 Peptide - middle region
Product Specifications
Product Name Alternative
DGCR8, C22orf12, DGCRK6, LP4941
UniProt
Q8WYQ5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DGCR8 Rabbit Polyclonal Antibody (orb588245) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_073557
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TEEKYGGDSDHPSDGETSVQPMMTKIKTVLKSRGRPPTEPLPDGWIMTFH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
OR22102 1 Each
2-chloro-3-[ ({[di (2-thienyl) methylene]amino}oxy) carbonyl]pyridine
Sign In for Pricing
View Details 
124218-ML490 100 µL
CACNG1 (Voltage-dependent Calcium Channel gamma-1 Subunit, Dihydropyridine-sensitive L-type, Skeletal Muscle Calcium Channel Subunit gamma, CACNLG) (MaxLight 490)
Sign In for Pricing
View Details