Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DGCR8 Peptide - middle region

DGCR8 Peptide - middle region

Product Specifications

Product Name Alternative

DGCR8, C22orf12, DGCRK6, LP4941

UniProt

Q8WYQ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DGCR8 Rabbit Polyclonal Antibody (orb588245) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_073557

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TEEKYGGDSDHPSDGETSVQPMMTKIKTVLKSRGRPPTEPLPDGWIMTFH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFYAP AAV siRNA Pooled Vector
62807161 1.0 µg

NFYAP AAV siRNA Pooled Vector

Sign In for Pricing
View Details
RT1-Cl ORF Vector (Rat) (pORF)
42826016 1.0 µg DNA

RT1-Cl ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
9630033F20Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4930306 1.0 µg DNA

9630033F20Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
7-[2- (2-Thienyl) vinyl][1,2,4]triazolo-[1,5-a]pyrimidin-2-amine
sc-319598A 5 mg

7-[2- (2-Thienyl) vinyl][1,2,4]triazolo-[1,5-a]pyrimidin-2-amine

Sign In for Pricing
View Details
Olfr821 Mouse shRNA Plasmid (Locus ID 258772)
TL507905 1 Kit

Olfr821 Mouse shRNA Plasmid (Locus ID 258772)

Sign In for Pricing
View Details
Zfpm2 Mouse Gene Knockout Kit (CRISPR)
KN520061 1 Kit

Zfpm2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details