EIF3F Peptide - middle region
EIF3F Peptide - middle region
Product Specifications
Product Name Alternative
EIF3F {ECO:0000255|HAMAP-Rule:MF_03005
UniProt
O00303
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EIF3F Rabbit Polyclonal Antibody (orb588258) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_003745
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLI
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV742093 1.0 µg DNA
PTMAP7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
Sign In for Pricing
View Details ![Mouse Monoclonal SUMO2/3 Antibody (SM23/496) [DyLight 680]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
NBP2-34717FR 0.1 mL
Mouse Monoclonal SUMO2/3 Antibody (SM23/496) [DyLight 680]
Sign In for Pricing
View Details 
