Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4EBP1 Peptide - C-terminal region

EIF4EBP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BP-1, 4EBP1, 4E-BP1, PHAS-I

UniProt

Q13541

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF4EBP1 Rabbit Polyclonal Antibody (orb588259) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004086

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (3,4-dichlorophenyl) -2- (1,2,3,4-tetrahydroquinolyl) ethanamide
ENA07965 250 mg

N- (3,4-dichlorophenyl) -2- (1,2,3,4-tetrahydroquinolyl) ethanamide

Sign In for Pricing
View Details
MRP-S35 shRNA Plasmid (m)
sc-149632-SH 20 µg

MRP-S35 shRNA Plasmid (m)

Sign In for Pricing
View Details
MEK kinase-4 (E-6) Alexa Fluor® 488
sc-166197 AF488 200 µg/mL

MEK kinase-4 (E-6) Alexa Fluor® 488

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Fumarate reductase subunit D (frdD), partial
MBS7083094 Inquire

Recombinant Haemophilus influenzae Fumarate reductase subunit D (frdD), partial

Sign In for Pricing
View Details
Mouse Lens Epithelial Cell Complete Medium
CM-M119-01 100 mL

Mouse Lens Epithelial Cell Complete Medium

Sign In for Pricing
View Details
Mouse Lens Epithelial Cell Complete Medium
CM-M119-02 4x 125 mL

Mouse Lens Epithelial Cell Complete Medium

Sign In for Pricing
View Details