Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4EBP1 Peptide - C-terminal region

EIF4EBP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BP-1, 4EBP1, 4E-BP1, PHAS-I

UniProt

Q13541

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF4EBP1 Rabbit Polyclonal Antibody (orb588259) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004086

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ifi27l2b sgRNA CRISPR Lentivector (Rat) (Target 3)
K6300104 1.0 µg DNA

Ifi27l2b sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Calpastatin/CAST Rabbit Polyclonal Antibody (APC)
orb2616810 100 µg

Calpastatin/CAST Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
TAGAP (NM_152133) Human Over-expression Lysate
LC407719 20 µg

TAGAP (NM_152133) Human Over-expression Lysate

Sign In for Pricing
View Details
MEK-1/2 (phospho Ser218/222) Polyclonal Antibody
E44H00626 100 µL

MEK-1/2 (phospho Ser218/222) Polyclonal Antibody

Sign In for Pricing
View Details
1,2-Bis (2,4,6-tribromophenoxy) ethane
OR52482 1 g

1,2-Bis (2,4,6-tribromophenoxy) ethane

Sign In for Pricing
View Details
Rabbit Polyclonal TMEM135 Antibody [PerCP]
NBP2-81869PCP 0.1 mL

Rabbit Polyclonal TMEM135 Antibody [PerCP]

Sign In for Pricing
View Details