IFI35 Peptide - N-terminal region
IFI35 Peptide - N-terminal region
Product Specifications
Product Name Alternative
IFP35
UniProt
P80217
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IFI35 Rabbit Polyclonal Antibody (orb327302) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
XP_005257359
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GP-6601-5 1 mL
Colloidal Gold Conjugated Cicer arietinum Lectin (Chick Pea) -CPA-, 5nm
Sign In for Pricing
View Details