Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRR1 Peptide - N-terminal region

KRR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KRR1, HRB2

UniProt

Q13601

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRR1 Rabbit Polyclonal Antibody (orb588293) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tin(IV) 2,3-naphthalocyanine Dichloride
TRC-T444088-250MG 250 mg

Tin(IV) 2,3-naphthalocyanine Dichloride

Sign In for Pricing
View Details
PKC-beta 1 Antibody
KC-1361-01 50 μL

PKC-beta 1 Antibody

Sign In for Pricing
View Details
PKC-beta 1 Antibody
KC-1361-02 100 µL

PKC-beta 1 Antibody

Sign In for Pricing
View Details
PKC-beta 1 Antibody
KC-1361-03 1 mL

PKC-beta 1 Antibody

Sign In for Pricing
View Details
TMED1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7D2]
TA503620AM 100 µL

TMED1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7D2]

Sign In for Pricing
View Details
Recombinant PEF1 Antibody
RC-4931-01 50 μL

Recombinant PEF1 Antibody

Sign In for Pricing
View Details