Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRR1 Peptide - N-terminal region

KRR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KRR1, HRB2

UniProt

Q13601

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRR1 Rabbit Polyclonal Antibody (orb588293) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Mouse TCRβ Antibody[H57-597]
E-AB-F1123E-01 50 Tests

APC Anti-Mouse TCRβ Antibody[H57-597]

Sign In for Pricing
View Details
APC Anti-Mouse TCRβ Antibody[H57-597]
E-AB-F1123E-02 100 Tests

APC Anti-Mouse TCRβ Antibody[H57-597]

Sign In for Pricing
View Details
APC Anti-Mouse TCRβ Antibody[H57-597]
E-AB-F1123E-03 2x 100 Tests

APC Anti-Mouse TCRβ Antibody[H57-597]

Sign In for Pricing
View Details
ODR4 (C1orf27) Human Gene Knockout Kit (CRISPR)
KN401504 1 Kit

ODR4 (C1orf27) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IFluor® 647-Wheat Germ Agglutinin (WGA) Conjugate
25559-AAT 1 mg

IFluor® 647-Wheat Germ Agglutinin (WGA) Conjugate

Sign In for Pricing
View Details
IST1 (NM_014761) Human Over-expression Lysate
LY402372 100 µg

IST1 (NM_014761) Human Over-expression Lysate

Sign In for Pricing
View Details