Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEPT2 Peptide - C-terminal region

SEPT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SEPT2, DIFF6, KIAA0158, NEDD5

UniProt

Q15019

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEPT2 Rabbit Polyclonal Antibody (orb55739) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_006712612

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fas (TNFRSF6) associated factor 1 (CPTC-FAF1-2), 1mg/mL
BNUM2268-50 1x 50 µL

Fas (TNFRSF6) associated factor 1 (CPTC-FAF1-2), 1mg/mL

Sign In for Pricing
View Details
Mouse Monoclonal NDUFB11 Antibody (OTI9C5) [Alexa Fluor 488]
NBP2-72916AF488 0.1 mL

Mouse Monoclonal NDUFB11 Antibody (OTI9C5) [Alexa Fluor 488]

Sign In for Pricing
View Details
Betulinic acid methyl ester
379689 10 mg

Betulinic acid methyl ester

Sign In for Pricing
View Details
Anti-GPR35 Antibody Picoband® Cy3 Conjugated
A06269-1-Cy3 100 µg/Vial

Anti-GPR35 Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal sFRP-2 Antibody (OTI6C2) [CoraFluor 1]
NBP2-74151CL1 0.1 mL

Mouse Monoclonal sFRP-2 Antibody (OTI6C2) [CoraFluor 1]

Sign In for Pricing
View Details
DNM1P26 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV760049 1.0 µg DNA

DNM1P26 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details