Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEPT2 Peptide - C-terminal region

SEPT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SEPT2, DIFF6, KIAA0158, NEDD5

UniProt

Q15019

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEPT2 Rabbit Polyclonal Antibody (orb55739) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_006712612

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flask 24/40 Joint, 2 Litre
T2063930/32A 1 Each

Flask 24/40 Joint, 2 Litre

Sign In for Pricing
View Details
ART1 Blocking Peptide
33R-4420 100 ug

ART1 Blocking Peptide

Sign In for Pricing
View Details
Ribonuclease A2 (RNASE2) Antibody
abx132158-01 100 µL

Ribonuclease A2 (RNASE2) Antibody

Sign In for Pricing
View Details
Ribonuclease A2 (RNASE2) Antibody
abx132158-02 200 µL

Ribonuclease A2 (RNASE2) Antibody

Sign In for Pricing
View Details
Ribonuclease A2 (RNASE2) Antibody
abx132158-03 1 mL

Ribonuclease A2 (RNASE2) Antibody

Sign In for Pricing
View Details
RXRA (FLJ16733, Retinoid X Receptor alpha, FLJ00280, FLJ00318) (Biotin)
MBS6436508-01 0.1 mL

RXRA (FLJ16733, Retinoid X Receptor alpha, FLJ00280, FLJ00318) (Biotin)

Sign In for Pricing
View Details