Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ORC4 Peptide - C-terminal region

ORC4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ORC4, ORC4L

UniProt

O43929

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ORC4 Rabbit Polyclonal Antibody (orb327316) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVVMKAFEH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trehalose Microplate Assay Kit
RDSM029 100 Assays

Trehalose Microplate Assay Kit

Sign In for Pricing
View Details
WSCD2 Mouse Monoclonal Antibody [9-F3]
M1010-2 100 µL

WSCD2 Mouse Monoclonal Antibody [9-F3]

Sign In for Pricing
View Details
TRITC Conjugated Rabbit Polyclonal Antibody to Swine IgG
RA-2359-2 2 mL

TRITC Conjugated Rabbit Polyclonal Antibody to Swine IgG

Sign In for Pricing
View Details
InstantChek Protein A Gold Kit
IC-GP-01-100 1 Each

InstantChek Protein A Gold Kit

Sign In for Pricing
View Details
LAS-34823
TRC-L395030-50MG 50 mg

LAS-34823

Sign In for Pricing
View Details
Human FAT3 activation kit by CRISPRa
GA114710 1 Kit

Human FAT3 activation kit by CRISPRa

Sign In for Pricing
View Details