ORC4 Peptide - C-terminal region
ORC4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ORC4, ORC4L
UniProt
O43929
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ORC4 Rabbit Polyclonal Antibody (orb327316) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVVMKAFEH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP02356PU-S 50 µL
p95 NBS1 (NBN) pSer343 Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
TRC-C365000-10G 10 g
2-Chloro-4H-1,3,2-benzodioxaphosphorin-4-one (90%)
Sign In for Pricing
View Details 