Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEX6 Peptide - C-terminal region

PEX6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PEX6, PXAAA1

UniProt

Q13608

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PEX6 Rabbit Polyclonal Antibody (orb588419) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000278

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSRGRSGDSGGVMDRVVSQLLAELDGLHSTQDVFVIGATNRPDLLDPALL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-4 Allophycocyanin Antibody (Clone 1067629)
IC11474A-100 100 Tests

Human IL-4 Allophycocyanin Antibody (Clone 1067629)

Sign In for Pricing
View Details
Sod3 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K5027904 1.0 µg DNA

Sod3 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
BIP/GRP78 Rabbit pAb
MBS8541707-01 0.1 mL

BIP/GRP78 Rabbit pAb

Sign In for Pricing
View Details
BIP/GRP78 Rabbit pAb
MBS8541707-02 0.1 mL (AF405L)

BIP/GRP78 Rabbit pAb

Sign In for Pricing
View Details
BIP/GRP78 Rabbit pAb
MBS8541707-03 0.1 mL (AF405S)

BIP/GRP78 Rabbit pAb

Sign In for Pricing
View Details
BIP/GRP78 Rabbit pAb
MBS8541707-04 0.1 mL (AF610)

BIP/GRP78 Rabbit pAb

Sign In for Pricing
View Details