Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEX6 Peptide - C-terminal region

PEX6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PEX6, PXAAA1

UniProt

Q13608

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PEX6 Rabbit Polyclonal Antibody (orb588419) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000278

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSRGRSGDSGGVMDRVVSQLLAELDGLHSTQDVFVIGATNRPDLLDPALL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1083-ps Mouse qPCR Primer Pair (NM_207564)
MP209324 200 Reactions

Olfr1083-ps Mouse qPCR Primer Pair (NM_207564)

Sign In for Pricing
View Details
Butyryl-d7 Chloride
TRC-B810512-50MG 50 mg

Butyryl-d7 Chloride

Sign In for Pricing
View Details
Chicken ghcagons-like pepfide 1 (GLP-1) ELISA Kit
201-16-2004 96 Tests

Chicken ghcagons-like pepfide 1 (GLP-1) ELISA Kit

Sign In for Pricing
View Details
CDC16 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV621570 1.0 µg DNA

CDC16 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Anti-Human CD124/IL4R Antibody (SAA0046), PE
FHD62612 100 Tests

Anti-Human CD124/IL4R Antibody (SAA0046), PE

Sign In for Pricing
View Details
RIP2 Rabbit mAb
60270 50 µL

RIP2 Rabbit mAb

Sign In for Pricing
View Details