Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGCC Peptide - middle region

RGCC Peptide - middle region

Product Specifications

Product Name Alternative

RGCC, C13orf15, RGC32

UniProt

Q9H4X1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RGCC Rabbit Polyclonal Antibody (orb327370) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_054778

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhodanine
Fr14380 50 mg

Rhodanine

Sign In for Pricing
View Details
MTAP (NM_002451) Human Tagged Lenti ORF Clone
RC206024L2 10 µg

MTAP (NM_002451) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Goat WD Repeat Containing Protein 24 (WDR24) ELISA Kit
MBS7260374-01 48 Well

Goat WD Repeat Containing Protein 24 (WDR24) ELISA Kit

Sign In for Pricing
View Details
Goat WD Repeat Containing Protein 24 (WDR24) ELISA Kit
MBS7260374-02 96 Well

Goat WD Repeat Containing Protein 24 (WDR24) ELISA Kit

Sign In for Pricing
View Details
Goat WD Repeat Containing Protein 24 (WDR24) ELISA Kit
MBS7260374-03 5x 96 Well

Goat WD Repeat Containing Protein 24 (WDR24) ELISA Kit

Sign In for Pricing
View Details
Goat WD Repeat Containing Protein 24 (WDR24) ELISA Kit
MBS7260374-04 10x 96 Well

Goat WD Repeat Containing Protein 24 (WDR24) ELISA Kit

Sign In for Pricing
View Details