RGCC Peptide - middle region
RGCC Peptide - middle region
Product Specifications
Product Name Alternative
RGCC, C13orf15, RGC32
UniProt
Q9H4X1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RGCC Rabbit Polyclonal Antibody (orb327370) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_054778
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
T8665-15G-AP 100 µL
Troponin I, Cardiac (Cardiac Troponin I, Troponin I Cardiac Muscle, cTnI, TNNC1, CMD1FF, CMD2A, CMH7, MGC116817, RCM1, TNNI3) (AP) discontinued
Sign In for Pricing
View Details MBS1015537 Inquire
Recombinant Enterobacter sp. Universal stress protein B (uspB)
Sign In for Pricing
View Details